Protein Model on 3mj5_B_1_C_1 (TEMPLATE: 3mj5 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) B 1 (B) polymer(polypeptide(L)) [262 aa] Replicase polyprotein 1a :R1A_CVHSA
2 b C 1 (A) non-polymer(GRM) N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthalen-1-ylethyl]piperidine-4-carboxamide 1771M 1772G 1810P 1831Y (identity: 100.0 %/81.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3mj5_B_1 identity=81.3%
queryA      1617:TFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILA:1716
                :** *** ***** ******** * ***************** *** **************   ** *** * *** **** ******** **********:
3mj5_B_1      55:TFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILA: 154
SecStr          :       SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETTEE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHH:    
ExpBur          :eeeeeeeeeeeeeebeeebeeeeeebbeebeebbeebeebebeebeebbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbb:    

queryA      1717:YCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYEL:1816
                :* **************  * ***** * ********* ***  *** *************   * ** *** **  ** ******* ********* * *:
3mj5_B_1     155:YSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKL: 254
SecStr          :HTT  TTS   HHHHHHHHGGGB  TT EEEEEEE SSS EEEEEE THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE:    
ExpBur          :bbeeebeeebebeebbeebbeebebeebebbbbbebeeeeeeeeebeebebbbbeebbbbeebeeebeeebeeeeebebbbeebebebbbbbbeeeeeeb:    
Contact         :                                                      bb                                     b      

queryA      1817:KHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK:1878
                :  *** ** *********** *** ***** **** *** ****** ******* *******:
3mj5_B_1     255:QQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIK: 316
SecStr          :ETTS SEEEEEEEETTEEEEEEEEESSSEEEEETTEEEEESEEEEEEEEEEEE SEEE    :    
ExpBur          :eeeebebbbbbeeeeeeeebbbbbeeebbbebebeeeeeeeebebebbbbbbebeebebeee:    
Contact         :              b                                                                                     


Input Residue Numbers for Focused Sites

ex) 2,15,123