Protein Model on 3r24_B_1_A_1 (TEMPLATE: 3r24 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) B 1 (B) polymer(polypeptide(L)) [121 aa] Non-structural protein 10 and Non-structural protein 11 :R1A_CVHSA
2 b A 1 (A) polymer(polypeptide(L)) [292 aa] 2'-O-methyl transferase :R1AB_CVHSA 4293N 4294C 4295V 4296K 4297M 4298L 4299C 4300T 4310V 4312P 4322G 4323G 4324A 4325S 4330C 4331R 4333H 4346K 4347G 4348K 4349Y (identity: 100.0 %/98.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3r24_B_1 identity=98.3%
queryA      4263:NSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVG:4362
                :************* **************************************************************************************:
3r24_B_1      13:NSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVG: 112
SecStr          :HHHHHHHHHTSSSHHHHHHHHHHTT        B    S S   SEESS    TTEEEEESGGG HHHHHT   SSSSS  SSTTSEEEEEGGGTT HHH:    
ExpBur          :eeebbeebbeeeebeebbeebeeeeeeebeebeeeeeeeeeebebebeeeebeeebbbbbbebbbbbbbbeeeeeeeeeebebeeeebbbbeebbebbbb:    
Contact         :                              bbbbbbbb         b b         bbbb    bb b            bbbb             

queryA      4363:FTLKNTVCTVCGMWKGYGCS:4382
                :*** ****************:
3r24_B_1     113:FTLRNTVCTVCGMWKGYGCS: 132
SecStr          :HHHH  B TTT SBTTTT  :    
ExpBur          :bbeeeeebeeeebbeeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123