Protein Model on 4ylu_D_1_K_1 (TEMPLATE: 4ylu )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) D 1 (D) polymer(polypeptide(L)) [304 aa] ORF1a protein :A0A0A7E693_9BETC
2 b K 1 (C) non-polymer(R30) N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylmethyl)amino]phenyl}propanamide 3264S (identity: 100.0 %/52.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ylu_D_1 identity=52.2%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4ylu_D_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGSSS  HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeeeebbbbbbeebbbbbebbbbeeeeeeebebeebbeebeeeebebebbeeeeeebebebeeeeebbbebebeeebee:    
Contact         :b                                                                                                   

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
4ylu_D_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :   EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbbebebeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4ylu_D_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS   S  HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebeebeeeebbee---bbeebebbbbbbbebbbebe-eebeeeebeebeebebbbbbebb:    

queryA      3560:VRQCSGV:3566
                :  *  **:
4ylu_D_1     297:NMQIMGV: 303
SecStr          :HHHHS  :    
ExpBur          :bebeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123