Protein Model on 4yoi_B_1_A_1 (TEMPLATE: 4yoi )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4
2 b A 1 (A) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4 3264S 3265G 3267R(V) 3268K 3269M 3270A(S) 3272P 3273S 3274G 3277E 3385P 3386S(T) 3387G 3388V 3389Y(F) 3400K 3401G 3402S 3403F 3404L 3429E 3432T(N) 3433G 3435H 3477N 3546G 3548A(S) 3549L(T) 3562Q 3564S(M) (identity: 73.3 %/51.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4yoi_B_1 identity=51.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
4yoi_B_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGTTS  HHHHHHH  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbebeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebeeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :bb bbbb bbb  b                                                                                      

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
4yoi_B_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :   EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEESSS EEEEEEEEEEEETTEEEEE TTS BSSS  SSSS       :    
ExpBur          :eeeeeeeebeebebbbbbbbeebebeeeebbbbbebbbbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                        bbbbb          bbbbb                        b  bb b                         

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
4yoi_B_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHH   HHHHHHHHHH-HHH  TT  BTTBSS      HHHH:    
ExpBur          :eebbbbbbbbbbbbbbeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebebebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    
Contact         :                b                                                                     b bb          

queryA      3560:VRQCSGVTFQ:3569
                :  *  **  *:
4yoi_B_1     297:NMQVMGVVMQ: 306
SecStr          :HHH  S    :    
ExpBur          :eeebeeeeee:    
Contact         :  b b                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123