Protein Model on 5c5o_B_1_D_1 (TEMPLATE: 5c5o )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2] [assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) B 1 (B) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1AB_CVHSA
2 b D 1 (B) non-polymer(SDJ) (2S)-3-(1H-imidazol-5-yl)-2-({[(3S,4aR,8aS)-2-(N-phenyl-beta-alanyl)decahydroisoquinolin-3-yl]methyl}amino)propanal 3288T 3304H 3307C 3308T 3309S(A) 3312M 3403F 3404L 3405N 3406G 3407S 3408C 3426H 3427H 3429E 3450D 3451R(I) 3452Q (identity: 88.9 %/95.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5c5o_B_1 identity=95.7%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
5c5o_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  HHHHHS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eeeeeeeeebeebeebbbebbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeebbeeeeeeebebbbeeeebebeeeeeeebbbebebeeebeeebe:    
Contact         :                        b               b  bbb  b                                                   

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ******* ************:
5c5o_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeebbbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :                                       bbbbbb                 bb b                    bbb           

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
5c5o_B_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT       HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   SS HHHHHHH :    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeeeeebeebbeeeebebeebbbbbeebbeeebeeeebeeeeebebbbbbeebeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123