Protein Model on 5c8u_A_1_B_1 (TEMPLATE: 5c8u )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (A) polymer(polypeptide(L)) [133 aa] Non-structural protein 10 :R1AB_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [514 aa] Guanine-N7 methyltransferase :R1AB_CVHSA 4253Q(S) 4254A 4255G 4256N 4257A 4258T 4259E 4260V 4261P 4264S 4265T 4267L 4268S 4269F 4271A 4272F 4273A 4274V 4278K 4279A 4282D 4286S 4293N 4295V 4296K 4297M 4298L 4311T 4312P 4322G 4324A 4325S 4329Y 4331R 4332C 4333H 4334I 4336H 4341G 4342F 4343C 4346K 4347G 4348K 4349Y (identity: 97.8 %/97.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5c8u_A_1 identity=97.7%
queryA      4253:QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQI:4352
                : ********************** ****************************************************************************:
5c8u_A_1       5:SAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQI: 104
SecStr          :  S     GGGHHHHHHHHH SSHHHHHHHHHHTT        B    S S   SSBSS    SSEEEE  TTT HHHHTT   SSSSS  SSTTSBEEE:    
ExpBur          :eeeeeeeeeebeebbeebeeeeebbebbeeeeeeebebbeebeeeebebeeebebebeeeebeeebbbbbbebbbbbbbbebeeeeeeeeeebeeeebbb:    
Contact         :bbbbbbbbb  bb bbb bbbb   bb  b   b      b bbbb            bb         b bb   b bbbb b    bbb  bbbb   

queryA      4353:PTTCANDPVGFTLKNTVCTVCGMWKGYGCSCD:4384
                :************* ******************:
5c8u_A_1     105:PTTCANDPVGFTLRNTVCTVCGMWKGYGCSCD: 136
SecStr          :ETTGGGSHHHHHHH    TTTSS SSS  S  :    
ExpBur          :beebbebbbbbbeeeeebeeeeebeeeeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123