Protein Model on 5c8u_C_1_L_1 (TEMPLATE: 5c8u )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) C 1 (C) polymer(polypeptide(L)) [133 aa] Non-structural protein 10 :R1AB_CVHSA
2 b L 1 (C) non-polymer(ZN) ZINC ION 4370C 4372V 4373C 4381C 4383C (identity: 100.0 %/97.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5c8u_C_1 identity=97.7%
queryA      4253:QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQI:4352
                : ********************** ****************************************************************************:
5c8u_C_1       5:SAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQI: 104
SecStr          : SS     HHHHHHHHHHHH SSHHHHHHHHHHHT        EE    BS S S  SS  B SS EEEETGGG HHHHTT   SSSS   SSTTSEEEE:    
ExpBur          :eeeeeeeeeebeebbeebeeeeebeebbeebeeeebeebeebeebebebeeeeebebeeeebeeebebbbbebbbbbbbbebebeeeeeeeebeeeebbb:    

queryA      4353:PTTCANDPVGFTLKNTVCTVCGMWKGYGCSCD:4384
                :************* ******************:
5c8u_C_1     105:PTTCANDPVGFTLRNTVCTVCGMWKGYGCSCD: 136
SecStr          : SSSTT HHHHHHH  B TTT  BTTSS    :    
ExpBur          :beeebebbbbbeeeeeebeeeeebeeeebeee:    
Contact         :                 b bb       b b                                                                     


Input Residue Numbers for Focused Sites

ex) 2,15,123