Protein Model on 5eu8_A_1_A_2 (TEMPLATE: 5eu8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (A) polymer(polypeptide(L)) [300 aa] main protease :V9PIT1_9ALPC
2 b A 2 (A) polymer(polypeptide(L)) [300 aa] main protease :V9PIT1_9ALPC 3263Q(S) 3267R 3268K 3269M 3270A 3272P 3273S 3274G 3277E 3385P 3386S(G) 3387G(S) 3388V 3389Y 3402S 3404L(I) 3432T(N) 3433G 3541G 3547S(Y) 3561R 3562Q 3565G (identity: 73.9 %/44.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5eu8_A_1 identity=44.7%
queryA      3263:QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:3362
                : ** **** *** ** * * *  *   ****** * * ******         ***  *     ***     *  * *         * ***   ** **:
5eu8_A_1       5:SSGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRV-INYENELSSVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTP: 103
SecStr          :           TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGS S SSS -  HHHHHHT  GGGEEEEETTEEE EEE  EETTEEEEEESS  TT  :    
ExpBur          :eeebeeeeeebeebeebbbebbbeeebbbbbbbeeebbbbbbbbbeeeeee-bebeebeeeeeeeebebebeeeebebeeeebeebbbbbebeeebeeeb:    
Contact         :b   bbbb bbb  b                                                                                     

queryA      3363:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT:3462
                :  **    **  *  **** * *  **   **   ******  * *****         * **** **  * * *  ***  **   *    *  **   :
5eu8_A_1     104:EHKFKSVRPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVM: 203
SecStr          :  EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE SSS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebebbbbbbbeebeeeeeebbbbbeebbbeeebeebbebbbbbbeeeeebbbbbbbbeebeeebbbbbbbebebbeebebbeeeeebeeeee:    
Contact         :                      bbbbb            b b                           bb                             

queryA      3463:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ:3562
                :   ** * **** *** ***      **   *  *             *    * * **  *          *  *  *****    * *****  * **:
5eu8_A_1     204:SSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFTEIVS--TDAFNMLAAKTGYSVEKLLECIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQ: 300
SecStr          : HHHHHHHHHHHHHHT  TT  S    HHHHHHHHHTTTB     --SGGGHHHHHHHS  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHHH:    
ExpBur          :bbebbbbbbbbbbeeebeebebeeebebeebbebbeeeebeebee--eeebeebbeebeeebeebbbbbbe-beeebeeeebbeeeebbbbbbbebbeee:    
Contact         :                                                                              b     b             bb

queryA      3563:CSGV:3566
                :  **:
5eu8_A_1     301:MYGV: 304
SecStr          :HT  :    
ExpBur          :beee:    
Contact         :  b                                                                                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123