Protein Model on 5gwz_A_1_B_1 (TEMPLATE: 5gwz )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (B) polymer(polypeptide(L)) [299 aa] PEDV main protease :R1A_PEDV7
2 b B 1 (A) polymer(polypeptide(L)) [299 aa] PEDV main protease :R1A_PEDV7 3267R 3269M 3270A 3272P 3273S 3274G 3277E 3385P(A) 3386S(A) 3387G 3388V 3389Y 3390Q(G) 3391C(V) 3400K(R) 3401G 3402S 3404L(I) 3543T(Q) 3548A(T) 3562Q 3563C(M) 3564S(Y) 3565G (identity: 58.3 %/46.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5gwz_A_1 identity=46.1%
queryA      3265:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :* **** *** ** * * *  *   ****** * * ******  *        *     *   ***    *** * *    *    *  **   *  ***:
5gwz_A_1       7:GLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDIVMCPRHVIASSTTSTIDYDYALSVLRL--HNFSISSGNVFLGVVSATMRGALLQIKVNQNNVHTPK: 104
SecStr          :         HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG   SSS   HHHHHHH  G--GGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :ebebeeeebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeeeebebeebeeebee--eebebbeeeeebeeeebeeeebbbebebeeebeeebe:    
Contact         :  b bb bbb  b                                                                                       

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :*      **  *  **** *   ***   ** * ** *** ** *** * **    * *** *  **  * * * ** *  **   *  * *  *     :
5gwz_A_1     105:YTYRTVRPGESFNILACYDGAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSLF: 204
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebebbebbbbbbbeebeeeeeebbbbbebebbeeebeeebbbbbbbeeeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeeeb:    
Contact         :                     bbbbbbb        bbb b                                                           

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **** **** ***  * *         **  *        *    *    * * **  *    **   *  *   *  ***   * ****   **** :
5gwz_A_1     205:TENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMT--TVGNTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGHTSLTDEFTTGEVVRQM: 301
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB --     GGGHHHHHHHT  HHHHHHHHHHHTT -  S  BTTBSS      HHHHHHHH:    
ExpBur          :bebbbbbbbbbbeeebeebeeeeeeebeebbeebeeeebb--ebeeeeebeebeeeeebbbeebbbbbeebbee-beeeebeeeeebbbebbbebbbeee:    
Contact         :                                                                               b    b             bb

queryA      3564:SGV:3566
                : **:
5gwz_A_1     302:YGV: 304
SecStr          :H  :    
ExpBur          :eee:    
Contact         :bb                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123