Protein Model on 5hyo_B_1_A_1 (TEMPLATE: 5hyo )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) B 1 (B) polymer(polypeptide(L)) [301 aa] PEDV 3CLpro :A0A075EBR7_9ALPC
2 b A 1 (A) polymer(polypeptide(L)) [301 aa] PEDV 3CLpro :A0A075EBR7_9ALPC 3264S(A) 3265G 3266F(L) 3267R 3268K 3269M 3270A 3271F(Q) 3272P 3273S 3274G 3277E 3385P(A) 3386S(A) 3387G 3388V 3389Y 3390Q(G) 3391C(V) 3400K(R) 3401G 3402S 3403F 3404L(I) 3429E 3433G 3435H 3535L(H) 3537N 3541G 3542R(K) 3545L 3546G 3547S(Y) 3548A(T) 3553E 3562Q 3563C(M) (identity: 63.2 %/45.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5hyo_B_1 identity=45.7%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:3362
                : * **** *** ** * * *  *   ****** * * ******  *        *     *   ***    *** * * *  *    *  **   *  **:
5hyo_B_1       1:AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVLRL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTP:  98
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS SS SS  HHHHHHT  G--GGEEEEETTEE  EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeeeebebeebeeebee--eebebbeeeeebeeeeeeeeebbbebebeeebeeee:    
Contact         :bbbbbbbbbbb  b                                                                                      

queryA      3363:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT:3462
                :**      **  *  **** **  ***   ** * ** *** ** *** * **    * *** *  **  * * * ** *  **   *  * *  *    :
5hyo_B_1      99:KYTYRTVRPGESFNILACYDGSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSL: 198
SecStr          : EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebebbbbbbbbebeeeeeebbbbbebebbeeebeeebbbbbbbebeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeee:    
Contact         :                      bbbbbbb        bbbbb                        b   b b                           

queryA      3463:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ:3562
                : * **** **** ***  * *         **  *             *    * * **  *    **   *  *   *  ***   * ****   * **:
5hyo_B_1     199:FTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ: 295
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB    -- TTTTHHHHHHHT  HHHHHHHHHHHHT - S   SSSSSSS     HHHHHHH:    
ExpBur          :ebbbbbbbbbbbbeeebeebebeeebeeeebbeebeeeebbebe--eeeebeebeeeeebebeebbbbbeebeee-eeeeebeeeeebbbbbbbbbbbee:    
Contact         :                                                                        b b   bb  bbbb    b        b

queryA      3563:CSGVTF:3568
                :  **  :
5hyo_B_1     296:MYGVNL: 301
SecStr          :HH    :    
ExpBur          :beeeee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123