Protein Model on 5hyo_B_1_L_1 (TEMPLATE: 5hyo )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) B 1 (B) polymer(polypeptide(L)) [301 aa] PEDV 3CLpro :A0A075EBR7_9ALPC
2 b L 1 (B) non-polymer(MPD) (4S)-2-METHYL-2,4-PENTANEDIOL 3403F 3404L(I) 3405N 3407S(A) 3408C 3426H 3427H(Q) 3428M(L) 3429E 3435H (identity: 60.0 %/45.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5hyo_B_1 identity=45.7%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSE-DMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTP:3362
                : * **** *** ** * * *  *   ****** * * ******  *        *     *   ***    *** * * *  *    *  **   *  **:
5hyo_B_1       1:AGLRKMAQPSGVVEKCIVRVCYGNMALNGLWLGDTVICPRHVIASSTTSTIDYDYALSVLRL--HNFSISSGNVFLGVVGVTMRGALLQIKVNQNNVHTP:  98
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS SS SS  HHHHHHT  G--GGEEEEETTEE  EEEEEEETTEEEEEESS  TT  :    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeeeebebeebeeebee--eebebbeeeeebeeeeeeeeebbbebebeeebeeee:    

queryA      3363:KYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTT:3462
                :**      **  *  **** **  ***   ** * ** *** ** *** * **    * *** *  **  * * * ** *  **   *  * *  *    :
5hyo_B_1      99:KYTYRTVRPGESFNILACYDGSAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCYLHQLELGSGCHVGSDLDGVMYGGYEDQPTLQVEGASSL: 198
SecStr          : EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B:    
ExpBur          :eeeeeebeebebbbbbbbbebeeeeeebbbbbebebbeeebeeebbbbbbbebeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeee:    
Contact         :                                        bbb bb                 bbbb     b                           

queryA      3463:ITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQ:3562
                : * **** **** ***  * *         **  *             *    * * **  *    **   *  *   *  ***   * ****   * **:
5hyo_B_1     199:FTENVLAFLYAALINGSTWWLSSSRIAVDRFNEWAVHNGMTTVV--NTDCFSILAAKTGVDVQRLLASIQSLHKN-FGGKQILGYTSLTDEFTTGEVIRQ: 295
SecStr          : HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB    -- TTTTHHHHHHHT  HHHHHHHHHHHHT - S   SSSSSSS     HHHHHHH:    
ExpBur          :ebbbbbbbbbbbbeeebeebebeeebeeeebbeebeeeebbebe--eeeebeebeeeeebebeebbbbbeebeee-eeeeebeeeeebbbbbbbbbbbee:    

queryA      3563:CSGVTF:3568
                :  **  :
5hyo_B_1     296:MYGVNL: 301
SecStr          :HH    :    
ExpBur          :beeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123