Protein Model on 5tl6_A_1_F_1 (TEMPLATE: 5tl6 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (B) polymer(polypeptide(L)) [315 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b F 1 (B) non-polymer(SO4) SULFATE ION 1576N 1701R 1709N (identity: 100.0 %/82.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5tl6_A_1 identity=82.9%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :** ********** ***** ***************************  ****** *** ***** ******** * ***************** *** *:
5tl6_A_1       5:EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGG: 104
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TT    GGGTT EEEE   SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebbeeebbeeebeebbbebeebbeeebeeebeeeebbbbeeeeebeebbeebbeeeeeebbeebbebbeebeebebeebee:    
Contact         :            b                                                                                       

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :*************   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** :
5tl6_A_1     105:LTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT: 204
SecStr          :EE   S TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHTTT  HHHHHHHHHHTT  TT    HHHHHHHHHTTB  TT EEEEEEE SSS EEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbbbbbbbbbbbebeeeeeeebeebbeebbebbebeebebbbbbebeeeeeeeeeee:    
Contact         :                                     b       b                                                      

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :*************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** :
5tl6_A_1     205:GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV: 304
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEEEETTEEEEEEEEESSSEEEEETTEEEEES EEEEE:    
ExpBur          :ebebbbbeebbbbeebbeebeeebeeeeebebbbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebbbbbeeeebbebebeeeeebeebebeb:    

queryA      1864:TDVFYKENSYTTTIK:1878
                :******* *******:
5tl6_A_1     305:TDVFYKETSYTTTIK: 319
SecStr          :EEEEEE S EE    :    
ExpBur          :bbbbbebeebebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123