Protein Model on 5wkj_A_2_D_2 (TEMPLATE: 5wkj )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 2 (A) polymer(polypeptide(L)) [302 aa] Orf1a protein :A0A1L2E0X0_9BETC
2 b D 2 (A) non-polymer(B1S) (1R,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino)-1-hydroxy-3-[(3S)-2-oxopyrrolidin-3-yl]propane-1-sulfonic acid 3304H 3312M(L) 3403F 3404L 3405N(C) 3407S 3408C 3426H 3427H(Q) 3428M 3429E 3435H 3450D 3451R(K) 3452Q (identity: 73.3 %/52.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5wkj_A_2 identity=52.0%
queryA      3263:QSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANP:3359
                : **  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** ***:
5wkj_A_2       7:HSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIXXXANLRVVGHAMQGTLLKLTVDVANP: 106
SecStr          :           HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TTS SS  HHHHHHH  GGGEEEE   --- EE EEEEEEETTEEEEEESS  T:    
ExpBur          :ebebeeeeeebeebeebbbbbebeebebbbbbbeebbbbbbebbbeeeeeeebebeebeeebeeeebebeeee---eebebebeeeeebbbebebeeebe:    
Contact         :                                         b       b                                                  

queryA      3360:KTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGT:3459
                : ** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   *:
5wkj_A_2     107:STPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLT: 206
SecStr          :T  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS      :    
ExpBur          :eebeeeeeebeebeebbbbbbbebbeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeeeee:    
Contact         :                                           bbb bb                 bbbb     b              bbb       

queryA      3460:DTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFD:3558
                :*    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* *:
5wkj_A_2     207:DKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPED: 302
SecStr          :  B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS   SS HHH:    
ExpBur          :eeebbebbbbbbbbbbeeeeeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeeeebbbebbbebbbebe-eebeeeebeebeebebbbbbeb:    

queryA      3559:VVRQCSGV:3566
                :*  *  **:
5wkj_A_2     303:VNMQIMGV: 310
SecStr          :HHHHHH  :    
ExpBur          :bbeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123