Protein Model on 6w4h_B_1_H_1 (TEMPLATE: 6w4h )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) B 1 (B) polymer(polypeptide(L)) [116 aa] SARS-CoV-2 NSP10 :R1AB_SARS2
2 b H 1 (B) non-polymer(ZN) ZINC ION 4327C 4330C 4336H 4343C (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6w4h_B_1 identity=100.0%
queryA      4271:AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC:4370
                :****************************************************************************************************:
6w4h_B_1      21:AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC: 120
SecStr          :     HHHHHHHHHHTT        B    S S   SEESS    TTEEEEESGGG HHHHHT   SSGGG  SSTTSEEEEEGGGTT HHHHHHH  B :    
ExpBur          :eeeeebbeebeeebeeeeeeeeebeeeeeeeeeebebebeeeebeeebbbbbbebbbbbeeeeeebeeeeeebebeeeebbbbeebbebbbbbbeeeeeb:    
Contact         :                                                        b  b     b      b                           

queryA      4371:TVCGMWKGYGCSCDQL:4386
                :****************:
6w4h_B_1     121:TVCGMWKGYGCSCDQL: 136
SecStr          :TTT SEETBEE TT  :    
ExpBur          :eeeebbeeeebeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123