Protein Model on 6w6y_A_1_C_1 (TEMPLATE: 6w6y )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (A) polymer(polypeptide(L)) [168 aa] SARS-CoV-2 NSP3 :R1AB_SARS2
2 b C 1 (A) non-polymer(AMP) ADENOSINE MONOPHOSPHATE 1043A 1044D 1045I 1060A 1070G 1071V 1147P 1148L 1151A 1152G 1153I 1154F 1176A 1177V 1178F 1182L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6w6y_A_1 identity=100.0%
queryA      1025:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK:1124
                :****************************************************************************************************:
6w6y_A_1       3:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK: 102
SecStr          :     S EE SSSEEEEES HHHHHHHH  SEEEEEE TT    SHHHHHHHHHTTTHHHHHHHHHHHHH    TT EEEEE TTT SEEEEEE   GGG:    
ExpBur          :eeebeebeebeebbbbbebebbebbeebebebbbbbbeeebebeeeebbebbebbeeebbeebeeebeeeeebeebeebebebeebbeebbbbbbbbeee:    
Contact         :                  bbb              b         bb                                                     

queryA      1125:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE:1192
                :********************************************************************:
6w6y_A_1     103:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE: 170
SecStr          :T  GGGHHHHHHGGGGSSEEEE  TT GGG   HHHHHHHHHHH  SEEEEEE  HHHHHHHHHHHT :    
ExpBur          :eeeeeebeebbebbbebebbbbbbbbbeebebeeeebbebbbebbebebbbbbeeeeebeebbebeee:    
Contact         :                      bb  bbbb                     bbb   b                                          


Input Residue Numbers for Focused Sites

ex) 2,15,123