Protein Model on 6w75_D_1_IA_1 (TEMPLATE: 6w75 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) D 1 (D) polymer(polypeptide(L)) [115 aa] SARS-CoV-2 NSP10 :R1AB_SARS2
2 b IA 1 (D) non-polymer(ZN) ZINC ION 4370C 4373C 4381C 4383C (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6w75_D_1 identity=100.0%
queryA      4271:AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC:4370
                :****************************************************************************************************:
6w75_D_1      21:AFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC: 120
SecStr          :     HHHHHHHHHHTT        B    S S   SEESS    TTEEEEESGGG HHHHHT   SSTT   SSTTSEEEEEGGGTT HHHHHHH  B :    
ExpBur          :eeeeebbeebeeebeeeeeebeebeeeeeeeeeebebebeeeebeeebbbbbbebbbbbbeeeeebeeeeeebebeeeebbbbeebeebbbbbbbeeeeb:    
Contact         :                                                                                                   b

queryA      4371:TVCGMWKGYGCSCDQ:4385
                :***************:
6w75_D_1     121:TVCGMWKGYGCSCDQ: 135
SecStr          :TTT SBTTBB  TT :    
ExpBur          :eeeebbeeeebeeee:    
Contact         :  b       b b                                                                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123