Protein Model on 1lvo_C_1_HA_1 (TEMPLATE: 1lvo )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) C 1 (C) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU
2 b HA 1 (D) non-polymer(SO4) SULFATE ION 3269M 3561R (identity: 100.0 %/45.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1lvo_C_1 identity=45.2%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1lvo_C_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S  SS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeeeebeebeebbbebbbeeeebbbbbbeeebbbbbbbbbeeeeee-bebeeeeeebeeeebebbeeeeebeeeebeeeebbbbbebeeebeeebe:    
Contact         :     b                                                                                              

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1lvo_C_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSS      S  B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbebebeeebebbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeebebb:    

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1lvo_C_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB     --SGGGHHHHHHHT  HHHHHHHHHH-HHH  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bebbbbbbbbbbeeeeeebbeeeebeeeebbebbeeeebeebee--eeebeebbeeeebebebbbbbbee-beeebeeeebbeeeebbbebbbebbbeeb:    
Contact         :                                                                                                 b  

queryA      3564:SGV:3566
                : **:
1lvo_C_1     297:YGV: 299
SecStr          :T  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123