Protein Model on 1lvo_D_3_C_3 (TEMPLATE: 1lvo )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:4]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) D 3 (D) polymer(polypeptide(L)) [301 aa] Replicase, hydrolase domain :R1AB_CVPPU
2 b C 3 (C) polymer(polypeptide(L)) [300 aa] Replicase, hydrolase domain :R1AB_CVPPU 3264S 3267R 3269M 3270A 3271F(Q) 3272P 3273S 3274G 3277E 3385P 3386S(G) 3387G(S) 3388V 3389Y 3390Q(G) 3400K 3401G 3402S 3403F 3404L(I) 3429E 3435H 3541G 3543T 3546G(S) 3547S(Y) 3548A(G) 3553E 3562Q 3565G (identity: 73.3 %/44.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1lvo_D_3 identity=44.9%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1lvo_D_3       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbbeebbbbbbbbbeeeeee-bebeeebeeeeeeebebbeeeeebebeebeeeebbbbbebeeebeeebe:    
Contact         :b  b bbbbbb  b                                                                                      

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1lvo_D_3     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbeeebeebbbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeeeebb:    
Contact         :                     bbbbbb         bbbbb                        b     b                            

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1lvo_D_3     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHTTTTB     --GGGGHHHHHHHS  HHHHHHHHHH-HHH  TT  BTTBSS    S HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebbeeeebeeeebbebbeeeebeebee--eeebeebbeeeebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbeeee:    
Contact         :                                                                             b b  bbb    b        b 

queryA      3564:SGVTF:3568
                : **  :
1lvo_D_3     297:YGVNL: 301
SecStr          :H S  :    
ExpBur          :eeeee:    
Contact         : b                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123