#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 1uk4_A_1_C_1

Protein Model on 1uk4_A_1_C_1 (TEMPLATE: 1uk4 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHSA
2 b C 1 (G) polymer(polypeptide(L)) [5 aa] 5-mer peptide of inhibitor 3288T 3304H 3312M 3403F 3404L 3405N 3406G 3407S 3408C 3426H 3428M 3429E 3435H 3451R 3452Q 3453T 3455Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1uk4_A_1 identity=96.0%
queryA      3266:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYK:3365
                :******************************** ********** ****************** ******************** * ***** ********:
1uk4_A_1       3:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYK: 102
SecStr          :        HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  SGGGGS  HHHHHTT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  EEE:    
ExpBur          :eeeeebebeebeebbbebbbeebebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebeeeeeebebebeeeeebbbebebeeebeeebeee:    
Contact         :                      b               b       b                                                     

queryA      3366:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV:3465
                :******************************* ********************************************* ********************* :
1uk4_A_1     103:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITL: 202
SecStr          :E    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSSS       B HH:    
ExpBur          :eeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeebeebbb:    
Contact         :                                     bbbbbb                 b bb     b               bbb b          

queryA      3466:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG:3565
                :**************************************************************** *****************  ****************:
1uk4_A_1     203:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG: 302
SecStr          :HHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  SSS SS      HHHHHHHHTT:    
ExpBur          :bbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebbeeeebebbbbbebbebeeee:    

queryA      3566:V:3566
                :*:
1uk4_A_1     303:V: 303
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123