Protein Model on 2acf_C_1_J_1 (TEMPLATE: 2acf )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) C 1 (C) polymer(polypeptide(L)) [176 aa] Replicase polyprotein 1ab
2 b J 1 (C) non-polymer(GOL) GLYCEROL 1070G 1071V 1150S 1151A 1152G 1153I 1154F (identity: 100.0 %/72.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2acf_C_1 identity=72.9%
queryA      1023:IEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNV:1122
                :  ** * ********* **  *** **    * * *****  **************** *** ******  **** ***** ******** ******** :
2acf_C_1       7:MPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNL: 106
SecStr          :  S    S EESSSSEEEEES HHHHHHHH  SEEEEE  TT    SHHHHHHHHHTTTHHHHHHHHHHHHH    TT EEEEE TTT SEEEEE    T:    
ExpBur          :eeeeebeebeebeeebbbbebebbebbeebebebbbbebeeebebeeeebbebbebbeeebbeebeeeeeeeeebeebbebebebeebbeebbbbbbbee:    
Contact         :                                               bb                                                   

queryA      1123:NKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE:1192
                :* ******** ******    ************* *  ** *** **** ** ** ** **   *   * :
2acf_C_1     107:NAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLD: 176
SecStr          :TTT  GGGHHHHHHGGGGSSEEEE  TT GGG   HHHHHHHHHHH  SEEEEEES HHHHHHHHHHHHH:    
ExpBur          :eeeeeeeebeebbebbeeeeebbbbbbbeeebebeeeebbbbbbebbeebbbbbbeeeeebeebbeebee:    
Contact         :                           bbbbb                                                                    


Input Residue Numbers for Focused Sites

ex) 2,15,123