#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2ahm_E_1_A_1

Protein Model on 2ahm_E_1_A_1 (TEMPLATE: 2ahm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) E 1 (E) polymer(polypeptide(L)) [155 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
2 b A 1 (A) polymer(polypeptide(L)) [77 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 4022R 4025V 4026T 4029M 4030Q 4032M 4033L 4034F 4036M 4037L 4039K 4040L 4042N 4044A 4045L 4048I 4049I 4052A 4053R 4055G 4058P 4061I 4062I 4064L (identity: 100.0 %/97.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ahm_E_1 identity=97.4%
queryA      3980:LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNT:4079
                :********************************************************************************************** *** *:
2ahm_E_1      43:LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGT: 142
SecStr          :  TTTTT SS  STTTHHHHHHHHHHHHHHHTT   S  HHHHHHHHHHHHHHHHHHHHHH  HHHHHHHHHHHTT EESS    STT EEEEEE SHHH:    
ExpBur          :eeeeeeeeeeeeeeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebeeeebeeeeeebeeeebebebbbeeeeb:    
Contact         :                                          b  bb  bb bbb bb bb b bb  bb  bb b  b  bb b               

queryA      4080:YKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN:4134
                :******* *************************** *******************:
2ahm_E_1     143:YKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN: 197
SecStr          :HHHHEETTEEEETTEEEEEEEEE TTS B  GGG STTTGGGS S EEEEEEE  :    
ExpBur          :beebbeeeebebbebebebeebbbeeeeebeeeebeeeebeebeeebebbbeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123