#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2ahm_E_2_I_1

Protein Model on 2ahm_E_2_I_1 (TEMPLATE: 2ahm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) E 2 (E) polymer(polypeptide(L)) [155 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
2 b I 1 (A) non-polymer(GOL) GLYCEROL 4011Q (identity: 100.0 %/97.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ahm_E_2 identity=97.4%
queryA      3980:LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNT:4079
                :********************************************************************************************** *** *:
2ahm_E_2      43:LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGT: 142
SecStr          :  TTTTT SS  STTTHHHHHHHHHHHHHHHTT   S  HHHHHHHHHHHHHHHHHHHHHH  HHHHHHHHHHHTT EESS    STT EEEEEE SHHH:    
ExpBur          :eeeeeeeeeeeeeeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebeeeebeeeeeebeeeebebebbbeeeeb:    
Contact         :                               b                                                                    

queryA      4080:YKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN:4134
                :******* *************************** *******************:
2ahm_E_2     143:YKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN: 197
SecStr          :HHHHEETTEEEETTEEEEEEEEE TTS B  GGG STTTGGGS S EEEEEEE  :    
ExpBur          :beebbeeeebebbebebebeebbbeeeeebeeeebeeeebeebeeebebbbeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123