#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2ahm_G_2_A_1

Protein Model on 2ahm_G_2_A_1 (TEMPLATE: 2ahm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) G 2 (G) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
2 b A 1 (A) polymer(polypeptide(L)) [77 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 3986V 3990E 3993R (identity: 100.0 %/97.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ahm_G_2 identity=97.4%
queryA      3943:AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDN:4042
                :************** *************************************************************************************:
2ahm_G_2       6:AIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDN: 105
SecStr          :  GGGSTTSHHHHHHHHHHHHHHHHHHTT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH  :    
ExpBur          :eeeeeeeebebeeebeebeeeeeebeeeeeeeebbeebeeebeebeeebeeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebeeeee:    
Contact         :                                           b   b  b                                                 

queryA      4043:DALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA:4133
                :******************************* *** ******** *************************** ******************:
2ahm_G_2     106:DALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRA: 196
SecStr          :HHHHHHHHHHHTT EESS    STT EEEEEE SHHHHHHHEETTEEE SSSEEEEEEEE TTS B  STT STTTGGGS SSEEEEEEE :    
ExpBur          :eeeeeeeebeeeebeeeeeebeeeebebebbbeebebbeebbeeeebebbebebebeebbbeeeeebeeeebeeeebeebeeebebbbeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123