#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2ahm_H_2_D_2

Protein Model on 2ahm_H_2_D_2 (TEMPLATE: 2ahm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) H 2 (H) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
2 b D 2 (D) polymer(polypeptide(L)) [76 aa] Replicase polyprotein 1ab, light chain :R1AB_CVHSA 4019E 4022R 4025V 4026T 4029M 4030Q 4031T 4033L 4034F 4036M 4037L 4040L 4042N 4044A 4045L 4048I 4049I 4052A 4053R 4055G 4057V 4058P 4061I 4062I 4064L (identity: 100.0 %/97.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ahm_H_2 identity=97.4%
queryA      3944:IASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDND:4043
                :************* **************************************************************************************:
2ahm_H_2       7:IASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDND: 106
SecStr          :   S TTSHHHHHHHHHHHHHHHHHHTT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH  H:    
ExpBur          :eeeeeeebebeeeeeebeeeeeebeeeeeeeeebeeeeeebeebeeebeeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebeeeeee:    
Contact         :                                                                           b  b  bb  bbb bb bb  b b 

queryA      4044:ALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN:4134
                :****************************** *** ******** *************************** *******************:
2ahm_H_2     107:ALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN: 197
SecStr          :HHHHHHHHHHTT EESS    STT EEEEEE SHHHHHHHEETTEEEETTEEEEEEEEE TTS B  GGG SGGGSTTS SSEEEEEEE  :    
ExpBur          :eeeeebebeeeebeeeeeebeeeebebebbbeebebbeebbeeeebebbebebebeebbbeeeeebeeeebeeeebeebeeebebbbeebe:    
Contact         :bb  bb  bb b bb  bb b                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123