#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2amq_A_1_C_1

Protein Model on 2amq_A_1_C_1 (TEMPLATE: 2amq )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [303 aa] 3C-like proteinase :R1AB_CVHSA
2 b C 1 (C) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 3288T 3289T 3290L 3304H 3312M 3317Y 3403F 3404L 3405N 3406G 3407S 3408C 3426H 3427H 3428M 3429E 3431P 3435H 3450D 3451R 3452Q 3453T 3454A 3455Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2amq_A_1 identity=96.0%
queryA      3266:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYK:3365
                :******************************** ********** ****************** ******************** * ***** ********:
2amq_A_1       8:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYK: 107
SecStr          :        HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  SSS SS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  SEE:    
ExpBur          :eeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebebeeeeebbbebebeeebeeebeee:    
Contact         :                      bbb             b       b    b                                                

queryA      3366:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV:3465
                :******************************* ********************************************* ********************* :
2amq_A_1     108:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITL: 207
SecStr          :E    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B HH:    
ExpBur          :eeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebebbb:    
Contact         :                                     bbbbbb                 bbbb b   b              bbbbbb          

queryA      3466:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG:3565
                :**************************************************************** *****************  ****************:
2amq_A_1     208:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG: 307
SecStr          :HHHHHHHHHHHHT  TT  S    HHHHHHHHTTTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHHHT:    
ExpBur          :bbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebbebeebebbbbbebbebeeee:    

queryA      3566:VTF:3568
                :***:
2amq_A_1     308:VTF: 310
SecStr          :   :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123