#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2amq_B_1_D_1

Protein Model on 2amq_B_1_D_1 (TEMPLATE: 2amq )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [302 aa] 3C-like proteinase :R1AB_CVHSA
2 b D 1 (D) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 3287T 3288T 3289T 3290L 3304H 3312M 3403F 3406G 3407S 3408C 3426H 3427H 3428M 3429E 3431P 3435H 3450D 3451R 3452Q 3453T 3455Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2amq_B_1 identity=96.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
2amq_B_1       6:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 105
SecStr          :          HHHHTTEEEEEETTEEEEEEEEEEEEEEEGGGG  TTTTTS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEEEEEETT  E:    
ExpBur          :eebeeeebebeebebbbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebebeeeeebbbebebeeebeebbe:    
Contact         :                       bbbb             b       b                                                   

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ********************:
2amq_B_1     106:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 205
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebbeb:    
Contact         :                                       b  bbb                 bbbb b   b              bbbb b        

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
2amq_B_1     206:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 305
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHGGGTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHS:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbeebbeeebeeeebeeeeebbbbbbbebbeebb:    

queryA      3564:SG:3565
                :**:
2amq_B_1     306:SG: 307
SecStr          :  :    
ExpBur          :ee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123