Protein Model on 2fe8_A_2_C_2 (TEMPLATE: 2fe8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:4]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) A 2 (A) polymer(polypeptide(L)) [315 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b C 2 (C) polymer(polypeptide(L)) [313 aa] Replicase polyprotein 1ab :R1AB_CVHSA 1625D 1628R 1638T(L) 1639D 1640P(E) 1746R 1748L 1750V 1760T 1762L 1766E 1769M 1770Y 1771M 1785I 1786P 1788T(V) 1795K(Q) (identity: 77.8 %/82.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2fe8_A_2 identity=82.8%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :** ********** ***** ***************************  ****** *** ***** ******** * ***************** *** *:
2fe8_A_2       2:EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGG: 101
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TT    GGGTT EEEE   SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebbeeebbeeebeebbbebeebeeeebeeebeeeebbbbbeeeebeebbeebbebeeeebbbebbebbeebeebebeebee:    
Contact         :                                                             b  b         bbb                       

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :*************   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** :
2fe8_A_2     102:LTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT: 201
SecStr          :EE     TTTHHHHHHHHHHHTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TTS   HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeebebbbbbbbbbbbbebebeeeeebeebbbebbeebebeebebbbbeebeeeeeeeeeee:    
Contact         :                                                                                  b b b         b b 

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :*************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** :
2fe8_A_2     202:GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV: 301
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEES GGG EEEEEEESSSEEEEETTEEEEESEEEEEE:    
ExpBur          :ebebbbeeebbbbeebeeeeebebeeeeebebebbebebebbbbbbeeeeeebeeeebebbbbeeeeeeebebbbbbeeebbbebebeeeeebeebebbb:    
Contact         :  b  bbb             bb b      b                                                                    

queryA      1864:TDVFYKENSYTTTI:1877
                :******* ******:
2fe8_A_2     302:TDVFYKETSYTTTI: 315
SecStr          :EEEEEE SEEE   :    
ExpBur          :bbbbbebeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123