Protein Model on 2fe8_C_1_O_1 (TEMPLATE: 2fe8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3] [assembly_id:4] [assembly_id:5] [assembly_id:7]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) C 1 (C) polymer(polypeptide(L)) [313 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b O 1 (C) non-polymer(BR) BROMIDE ION 1821F 1822T(L) 1868Y 1869K (identity: 75.0 %/82.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2fe8_C_1 identity=82.7%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :** ********** ***** ***************************  ****** *** ***** ******** * ***************** *** *:
2fe8_C_1       2:EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGG: 101
SecStr          :   EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebeeeebbeeebeebbbebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbeebbebbeebeebebeebee:    

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :*************   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** :
2fe8_C_1     102:LTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT: 201
SecStr          :EE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TTS   HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbebebeeeeebeebbeebbeebebeebebbbbbebeeeeeeeeeee:    

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :*************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** :
2fe8_C_1     202:GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV: 301
SecStr          :THHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEES STT EEEEEEESSSEEEEETTEEEEESEEEEEE:    
ExpBur          :ebebbbbeebbbbeebeeebeeebeeeeebebebeebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebbbbbeeebbbebbbeeeeeeeebebbb:    
Contact         :                                                         bb                                         

queryA      1864:TDVFYKENSYTT:1875
                :******* ****:
2fe8_C_1     302:TDVFYKETSYTT: 313
SecStr          :EEEEEE SEEE :    
ExpBur          :bbbbbebeeeee:    
Contact         :    bb                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123