Protein Model on 2fyg_A_1_B_1 (TEMPLATE: 2fyg )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) A 1 (A) polymer(polypeptide(L)) [128 aa] Replicase polyprotein 1ab :Q6JH39_CVHSA
2 b B 1 (A) non-polymer(ZN) ZINC ION 4327C 4330C 4336H 4343C (identity: 100.0 %/98.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2fyg_A_1 identity=98.4%
queryA      4263:NSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVG:4362
                :************* **************************************************************************************:
2fyg_A_1       6:NSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVG: 105
SecStr          :HHHHHHHHHTSSSHHHHHHHHHHTT        B    S S   SEESS    TTEEEEETGGG HHHHHT   SSTT   SSTTSEEEEEGGGTT HHH:    
ExpBur          :beebbeebbeeeebeebbeebbeeeeeebeebeeeebeeeeebebebeeeebeeebbbbbbebbbbbbbbeeebeeeeeebebeeeebbbbeebbebbbb:    
Contact         :                                                                b  b     b      b                   

queryA      4363:FTLKNTVCTVCGMWKGYGCSCDQ:4385
                :*** *******************:
2fyg_A_1     106:FTLRNTVCTVCGMWKGYGCSCDQ: 128
SecStr          :HHHH  B TTT SBTTBB     :    
ExpBur          :bbeeeeebeeeebbeeeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123