Protein Model on 2g9t_B_1_BA_1 (TEMPLATE: 2g9t )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) B 1 (B) polymer(polypeptide(L)) [119 aa] orf1a polyprotein :Q692E5_CVHSA
2 b BA 1 (B) non-polymer(ZN) ZINC ION 4370C 4373C 4381C 4382S (identity: 100.0 %/95.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2g9t_B_1 identity=95.9%
queryA      4261:PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDP:4360
                :*************** **************************************************************   *******************:
2g9t_B_1       8:PANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDP: 107
SecStr          : TTHHHHHHHHTSSSHHHHHHHHHHTT        B    S S   SEESS    TTEEEEEHHHH HHHHHT     ---  SSTTSEEEEETTTTT H:    
ExpBur          :eebeebbeebbeeeebeebbeeeeeeeeeebeebeeeeeebeeebebebeeeebeeebebbbbebbbbbbbbeeeeee---ebebeeeebbbbeebbebb:    

queryA      4361:VGFTLKNTVCTVCGMWKGYGCS:4382
                :***** ****************:
2g9t_B_1     108:VGFTLRNTVCTVCGMWKGYGCS: 129
SecStr          :HHHHHH  B TTT SBTTBB  :    
ExpBur          :bbbbeebeebeeebbbeeeebe:    
Contact         :         b  b       bb                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123