Protein Model on 2g9t_C_1_J_1 (TEMPLATE: 2g9t )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) C 1 (C) polymer(polypeptide(L)) [118 aa] orf1a polyprotein :Q692E5_CVHSA
2 b J 1 (J) polymer(polypeptide(L)) [118 aa] orf1a polyprotein :Q692E5_CVHSA 4310V 4311T 4313E 4348K 4371T 4372V (identity: 100.0 %/95.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2g9t_C_1 identity=95.9%
queryA      4262:ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPV:4361
                :************** **************************************************************   ********************:
2g9t_C_1       9:ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPV: 108
SecStr          : HHHHHHHHHTSSSHHHHHHHHHHTT        B    S S   SEESS    TTEEEEETGGG HHHHTT     ---  SSTTSEEEEEGGGTT HH:    
ExpBur          :ebeebbeebbeeeebeebbeeeeeeeeeebeebeeeeeeeeeebebebeeeebeeebbbbbbebbbbbbbbeeebee---ebebeeeebbbbeebbebbb:    
Contact         :                                                bb b                                  b             

queryA      4362:GFTLKNTVCTVCGMWKGYGCS:4382
                :**** ****************:
2g9t_C_1     109:GFTLRNTVCTVCGMWKGYGCS: 129
SecStr          :HHHHH  B TTT SBTTBB  :    
ExpBur          :bbbeebeebeeebbbeeeebe:    
Contact         :         bb                                                                                         


Input Residue Numbers for Focused Sites

ex) 2,15,123