Protein Model on 2g9t_J_1_I_1 (TEMPLATE: 2g9t )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) J 1 (J) polymer(polypeptide(L)) [118 aa] orf1a polyprotein :Q692E5_CVHSA
2 b I 1 (I) polymer(polypeptide(L)) [118 aa] orf1a polyprotein :Q692E5_CVHSA 4295V 4296K 4297M 4298L 4312P 4349Y (identity: 100.0 %/95.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2g9t_J_1 identity=95.9%
queryA      4262:ANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPV:4361
                :************** **************************************************************   ********************:
2g9t_J_1       9:ANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNXXXFCDLKGKYVQIPTTCANDPV: 108
SecStr          : HHHHHHHHHTSSSHHHHHHHHHHTT        B    S S   SEESS    TTEEEEETGGG HHHHTT     ---  SSTTSEEEEETTTTT HH:    
ExpBur          :ebeebbeebbeeeebbebbeeeeeeeeeebeebeeeeeebeeebebebeeeebeeebebbbbebbbbbbbbeeebee---ebebeeeebbbbeebbebbb:    
Contact         :                                 bbbb             b                                    b            

queryA      4362:GFTLKNTVCTVCGMWKGYGCS:4382
                :**** ****************:
2g9t_J_1     109:GFTLRNTVCTVCGMWKGYGCS: 129
SecStr          :HHHHH  B TTTSSBTTBB  :    
ExpBur          :bbbeeeeebeeeebbeeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123