#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2q6g_B_1_D_1

Protein Model on 2q6g_B_1_D_1 (TEMPLATE: 2q6g )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [302 aa] severe acute respiratory syndrome coronavirus (SARS-CoV) :R1AB_CVHSA
2 b D 1 (D) polymer(polypeptide(L)) [8 aa] Polypeptide chain 3287T 3288T 3289T 3290L 3304H(A) 3312M 3317Y 3403F 3404L 3405N 3406G 3407S 3408C 3426H 3427H 3428M 3429E 3431P 3435H 3450D 3451R 3452Q 3453T 3454A 3455Q (identity: 96.0 %/95.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2q6g_B_1 identity=95.7%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ***** **** ****************** ******************** * ***** ******:
2q6g_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TGGGGS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  E:    
ExpBur          :eebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebeeeeeebebeeeeebebbbebebeeebeebbe:    
Contact         :                       bbbb             b       b    b                                              

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ********************:
2q6g_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS SS       B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebebeeebeb:    
Contact         :                                       bbbbbb                 bbbb b   b              bbbbbb        

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
2q6g_B_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHGGG  HHHHHHHHHHHHHH  TT  BTTBSS      HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebbeeeebbbbbbbebbeeee:    

queryA      3564:SG:3565
                :**:
2q6g_B_1     301:SG: 302
SecStr          :H :    
ExpBur          :ee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123