#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 2w2g_B_1_D_1

Protein Model on 2w2g_B_1_D_1 (TEMPLATE: 2w2g )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [256 aa] NON-STRUCTURAL PROTEIN 3 :R1A_CVHSA
2 b D 1 (B) non-polymer(SO4) SULFATE ION 1436N(T) 1439N 1470K(R) (identity: 33.3 %/73.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2w2g_B_1 identity=73.8%
queryA      1235:CVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGL:1334
                :*  *************  ***  **** *  **       *  ** ***** ****   *  * **** **********  ** *** * ********* :
2w2g_B_1       5:CIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGC: 104
SecStr          : EEE SS HHHHTTT   EEEEE TTS B HHHHTT SS   GGGTTT S  TT EEEETTEEEEE   GGGT  HHHHHHHHTTS SSEEEE  TT ST:    
ExpBur          :eeeebeeebeebeeebeebbbbbeeebebbebbeebbeeeebebbeeeeebeebeebeeeebbbbbbbeeeeebebeebbebbeebeeeebbbbbbbbeb:    

queryA      1335:NGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASL:1434
                : *** ***** ********* ***       ************************* *    **  ************** **** ** *****  *** :
2w2g_B_1     105:AGYTLEEAKTALKKCKSAFYVLPSEAPXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASI: 204
SecStr          :TS  HHHHHHHHHHSSSEEEE   S  ----    EE   HHHHHHHHHHH  EEEEETT HHHHHHHHHHTTT    SEEEESSSEEEEE SSS HHHH:    
ExpBur          :ebbebeebeebbeebebebebbeeeee----eeeebeeeebeebbebbeeeeebbbbbbeeeebbeebeeebeebeeeebebeeebbbbbbbeebebbeb:    

queryA      1435:INTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSS:1494
                :*  ** *** ***** ****** ******* ****  ** ********** *********:
2w2g_B_1     205:ITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLRAPAVVSVSSPDAVTTYNGYLTSSS: 264
SecStr          :HHHHHHH   EEE  TTBTTTSB HHHHHHHHTT  S EEEE SSHHHHHHHHHHHHS  :    
ExpBur          :beebbeeeeebbbebbbeeeeebebeebbebbbbbebeebbbbeeeebbeebbeebeeee:    
Contact         : b  b                              b                                                                


Input Residue Numbers for Focused Sites

ex) 2,15,123