Protein Model on 2wct_B_1_C_1 (TEMPLATE: 2wct )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) B 1 (B) polymer(polypeptide(L)) [257 aa] NON-STRUCTURAL PROTEIN 3 :R1A_CVHSA
2 b C 1 (C) polymer(polypeptide(L)) [252 aa] NON-STRUCTURAL PROTEIN 3 :R1A_CVHSA 1259I 1260N 1282D 1283A 1284P 1285Y 1286I(M) 1287V 1305K 1306A 1307G 1312M 1315K(R) 1394E(D) 1396K(R) 1427S 1428K 1453V 1454T 1455H 1456G 1457L(F) 1458N 1461E (identity: 79.2 %/74.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2wct_B_1 identity=74.2%
queryA      1231:KIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYP:1330
                :*****  *************  ***  **** *  **       *  ** ***** ****   *  * **** **********  ** *** * ******:
2wct_B_1       1:KIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYP: 100
SecStr          : EEEE  SSS  HHHHTTT   EEEEE SSS B HHHHHT SS    TTTSS S  TT EEEETTEEEEE   TTTT  HHHHHHHHTTS SSEEEE  S:    
ExpBur          :eeeeebeeeebbeeebeeebeebbbbbeeebebbebbeebbeeeeeebbeeeeebeebeebeeeebbbbbbbeeeeebeeeebbebbeebeeeebbbbbb:    
Contact         :                            bb                     bbbbbb                 bbb    b  b               

queryA      1331:GQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTT:1430
                :***  *** ***** ********* ***       ************************* *    **  ************** **** ** *****  :
2wct_B_1     101:GQGCAGYTLEEAKTALKKCKSAFYVLPSXXXXXXXEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEP: 200
SecStr          :S SSSS  HHHHHHHHHHSSSEEEE   ------- GGGEE   HHHHHHHHHHH  EEEEETT HHHHHHHHHHSTT    SEEEESSSEEEEE SSS :    
ExpBur          :bbebebbbbeebeebbeebebbbbbbee-------eeeebbeeebeebbebbeeeeebbbbbbeeeebbeebeeebeebeeeebebeeebebbbbbeebe:    
Contact         :                                                               b b                              bb  

queryA      1431:VASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSS:1494
                :*** *  ** *** ***** ****** ******* ****  ** ********** *********:
2wct_B_1     201:VASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLRAPAVVSVSSPDAVTTYNGYLTSSS: 264
SecStr          :HHHHHHHHHHHT  EEE  TTBTTTSB HHHHHHHHTT  S EEEE SSHHHHHHHHHHHHS  :    
ExpBur          :bbebbeebbeeeeebbbebbbeeeeeeebeebbebbeebebeebbbbeeeebbeebbeebeeeb:    
Contact         :                      bbbbbb  b                                                                     


Input Residue Numbers for Focused Sites

ex) 2,15,123