Protein Model on 3e9s_A_1_B_1 (TEMPLATE: 3e9s )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) A 1 (A) polymer(polypeptide(L)) [317 aa] Non-structural protein 3 :R1A_CVHSA
2 b B 1 (A) non-polymer(TTT) 5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]benzamide 1725L 1726G 1727D 1810P 1811P 1827Y 1831Y 1832Q 1836Y 1864T (identity: 100.0 %/82.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3e9s_A_1 identity=82.5%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :** ********** ***** ***************************  ****** *** ***** ******** * ***************** *** *:
3e9s_A_1       4:EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGG: 103
SecStr          :S  EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebbbbbbeeeeeeeebebeebbeeebeebbbebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbbbbbebbeebeebebeebee:    

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :********** **   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** :
3e9s_A_1     104:LTSIKWADNNUYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT: 203
SecStr          :EE     TT HHHHHHHHHHHTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTT  TTS   HHHHHHHHHTTB  TT EEEEEEE SSS EEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbebebebebebbeebbeebeeeebbbbbbbbbbbbebebeebbebeebbeebbebbebeebebbbbbebeeeeeeeeeee:    
Contact         :                                                             bbb                                    

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :*************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** :
3e9s_A_1     204:GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV: 303
SecStr          :THHHHEEES S HHHHHH EEEE SSSSEEEEEEEEEESSEEEEE S  EEEE TTS SEEEEEESSTTSSEEEEEEESSSEEEEETTEEEEES EEEEE:    
ExpBur          :ebebbbbeebbbbeebeeebeeebeeeeebebbbbebebbbbbbbbeeeeeebeeeebebbbbbeeeeeebebbbbbeeebbbebebeeeeeeeebebbb:    
Contact         :                                              bb               b   bb   b                           

queryA      1864:TDVFYKENSYTTTI:1877
                :******* ******:
3e9s_A_1     304:TDVFYKETSYTTTI: 317
SecStr          :EEEEEE S EE   :    
ExpBur          :bbbbbebeeeebee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123