#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3iwm_B_1_D_1

Protein Model on 3iwm_B_1_D_1 (TEMPLATE: 3iwm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA
2 b D 1 (D) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA 3266F 3267R 3268K 3269M 3271F 3372G 3373Q 3374T 3390Q 3391C 3392A 3394R 3395P 3460D 3461T 3462T 3463I 3464T 3465V(L) 3466N 3467V 3468L 3469A 3470W 3471L 3472Y 3473A 3474A 3475V 3476I 3479D 3481W 3482F 3483L 3484N 3485R 3486F 3487T 3493F 3501N 3502Y 3503E 3505L 3509H 3512I 3513L 3516L 3517S 3519Q 3520T 3522I 3523A 3524V 3526D 3527M 3528C 3529A 3530S(A) 3531L 3533E 3542R 3543T 3544I 3545L 3546G 3549L(I) 3550L 3551E 3552D 3553E 3554F 3555T 3556P 3558D 3559V 3561R 3562Q 3563C (identity: 96.2 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3iwm_B_1 identity=96.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
3iwm_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :         THHHHTTEEEEESSS EEEEEEETTEEE  TTSS  SSSSSS  HHHHBSSS TTS EEEETTEEEEEEEEEE SSSEEEEESS  TT  E:    
ExpBur          :eeeeeeeeebeebeebbbebbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeebbeebeeeebebbeeeeebebebeeeeebbbebebeeebeeebe:    
Contact         :  bbbb b                                                                                            

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ********************:
3iwm_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT  EEEEEEETTEEEEEEEE B TTS B     TT TT EEE EETTEEEE EEEEE  TTS BEEE TT  BSSS  SSSSS         :    
ExpBur          :eebeebeebeebbbbbbeebeeeeeebbebbebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeee:    
Contact         :        bbb               bbb bb                                                                bbbb

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
3iwm_B_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHTTT  TT       HHHHHHHHHHTT     HHHHHHHHHHHHHTT  HHHHHHHHHHHHTT  SS  BTTBSS      HHHHHHH :    
ExpBur          :eeeeeeeeebbeeeeeeeeeeeeebeeeebbebbeeeeeeebeeeebeeeeeeeeeeeeebeeebbeebeebeeebeeeeeeebeeeeeeeeeeeeeeee:    
Contact         :bbbbbbbbbbbbb  b bbbbbbb     b       bbb b   b  bb  bb bb bbb bbbbbb b        bbbbb  bbbbbbbb bb bbb

queryA      3564:S:3564
                :*:
3iwm_B_1     301:S: 301
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123