#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3iwm_B_2_F_2

Protein Model on 3iwm_B_2_F_2 (TEMPLATE: 3iwm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 2 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1A_CVHSA
2 b F 2 (F) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 3287T 3288T 3289T 3304H 3317Y 3403F 3405N 3406G 3408C 3426H 3427H 3428M 3429E 3431P 3435H 3450D 3452Q 3453T 3455Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3iwm_B_2 identity=96.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
3iwm_B_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :         THHHHTTEEEEESSS EEEEEEETTEEE  TTSS  SSSSSS  HHHHBSSS TTS EEEETTEEEEEEEEEE SSSEEEEESS  TT  E:    
ExpBur          :eeeeeeeeebeebeebbbebbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeebbeebeeeebebbeeeeebebebeeeeebbbebebeeebeeebe:    
Contact         :                       bbb              b            b                                              

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ********************:
3iwm_B_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT  EEEEEEETTEEEEEEEE B TTS B     TT TT EEE EETTEEEE EEEEE  TTS BEEE TT  BSSS  SSSSS         :    
ExpBur          :eebeebeebeebbbbbbeebeeeeeebbebbebebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeeeee:    
Contact         :                                       b bb b                 bbbb b   b              b bb b        

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
3iwm_B_2     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHTTT  TT       HHHHHHHHHHTT     HHHHHHHHHHHHHTT  HHHHHHHHHHHHTT  SS  BTTBSS      HHHHHHH :    
ExpBur          :eeeeeeeeebbeeeeeeeeeeeeebeeeebbebbeeeeeeebeeeebeeeeeeeeeeeeebeeebbeebeebeeebeeeeeeebeeeeeeeeeeeeeeee:    

queryA      3564:S:3564
                :*:
3iwm_B_2     301:S: 301
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123