#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3iwm_C_1_G_1

Protein Model on 3iwm_C_1_G_1 (TEMPLATE: 3iwm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA
2 b G 1 (G) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 3288T 3290L 3304H 3312M 3403F 3405N 3406G 3407S 3408C 3426H 3427H 3428M 3429E 3430L 3431P 3435H 3450D 3451R 3452Q 3453T 3454A (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3iwm_C_1 identity=96.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
3iwm_C_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :         SHHHHTTEEEEE SS EEEEEEETTEEE  TTTT  TTS SS  SSSSTTTS GGG EEEETTEEE    EEEETTEEEEE SS  TT  S:    
ExpBur          :eeeeeeeeebeebeebbbebbbeebebbbbbbeebbbbbbbbbbeeeeeeebebeebbeeeeeeebebeeeeeebebeebeeeebbbebebeeebeeebe:    
Contact         :                        b b             b       b                                                   

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ********************:
3iwm_C_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEE STT EEEEEEEEEE TTS EEEE TTS BSSS  SS SS         :    
ExpBur          :eeeeebeebeebbbbbbbebeeeeeebbebbebebbeeebeebbbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebbeeebebeeeeeb:    
Contact         :                                       b bbbb                 bbbbbb   b              bbbbb         

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
3iwm_C_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  GGGS     STTTGGGHHHH      HHHHHHHHHHHHHHT  HHHHHHHHHHHHTT  TT  BTTBSS   S  TTHHHHH :    
ExpBur          :eeeeeeeeebbbeeeeeeeeeeeebeeeebbebbeeeeeeebeeeebeeeeebeeeeeeebeeebbebbeebeeebeeeeeeebeeeeeeeeeeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123