#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4m0w_A_1_B_1

Protein Model on 4m0w_A_1_B_1 (TEMPLATE: 4m0w )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [317 aa] Replicase polyprotein 1a :R1A_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [76 aa] Ubiquitin :RS27A_BOVIN 1669W 1672N 1673N 1674C(S) 1675Y 1725L 1726G 1727D 1729R 1730E 1762L 1766E 1770Y 1771M 1786P 1788T(V) 1795K(Q) 1810P 1811P 1827Y 1831Y 1832Q 1833C 1834G 1836Y 1864T (identity: 88.5 %/82.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4m0w_A_1 identity=82.3%
queryA      1565:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL:1664
                :* ********** ***** ***************************  ****** *** ***** ******** * ***************** *** **:
4m0w_A_1       3:VKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGL: 102
SecStr          :  EEEEEEESSSSS EEEEEETTS HHHHTSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETTE:    
ExpBur          :eeebebebbbbeeeeeeeebbeeeebeeebeebbbebeebbeeebeeebeeeebbbebeeeebeebbeebbeeeeeebbeebbebbeebeebebeebeeb:    

queryA      1665:TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG:1764
                :********* **   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** *:
4m0w_A_1     103:TSIKWADNNSYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTG: 202
SecStr          :E   S TT HHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHHT  TT    HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEEG:    
ExpBur          :bbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbebebeeeeebeebbeebbebbebeebebbbbebbeeeeeeeeeeee:    
Contact         :    b  bbbb                                                 bbb bb                               b  

queryA      1765:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT:1864
                :************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** *:
4m0w_A_1     203:VEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVT: 302
SecStr          :GGGTEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEEE SS EEEEEEEESSSEEEEETTEEEEESEEEEEEE:    
ExpBur          :bebbbbeebbbbeebbeebeeebeeeeebebbbeebebebbbbbbeeeeeebeeeebebbbbbeeeeeeeebbbbbeeebbbebebeeeeebeebebbbb:    
Contact         : b   bb              b b      b              bb               b   bbbb b                           b

queryA      1865:DVFYKENSYTTTIKPVT:1881
                :****** ********* :
4m0w_A_1     303:DVFYKETSYTTTIKPVS: 319
SecStr          :EEEEE SEEE       :    
ExpBur          :bbbbebeeeebeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123