#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4mm3_B_1_A_1

Protein Model on 4mm3_B_1_A_1 (TEMPLATE: 4mm3 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [316 aa] Papain-like proteinase :R1A_CVHSA
2 b A 1 (A) polymer(polypeptide(L)) [76 aa] Ubiquitin :UBC_HUMAN 1672N 1674C 1675Y 1725L 1726G 1727D 1729R 1730E 1733S(T) 1762L 1766E 1770Y 1771M 1785I 1786P 1788T(V) 1795K(Q) 1810P 1827Y 1832Q 1833C 1834G 1835H 1836Y 1864T (identity: 88.0 %/82.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4mm3_B_1 identity=82.9%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :** ********** ***** ***************************  ****** *** ***** ******** * ***************** *** *:
4mm3_B_1       2:EVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGG: 101
SecStr          :  S    EEESSSSS EE    SS  SHHHH SEEETTEEGGG    SS SS EEEE   SSSHHHHHHHHH    STHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebeeeeebeeeeeebbbebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbeebbebbeebeebebeebee:    

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :*************   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** :
4mm3_B_1     102:LTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT: 201
SecStr          :EE   S TT HHHHHHHHHHTTS   BSSHHHHHHHHHHTTT  HHHHHHHHHHTT  TT    HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeebeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbeeebeeeeebeebbeebbebbebeebebbbbbebeeeeeeeeeee:    
Contact         :        b bb                                                 bbb bb  b                            b 

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :*************   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** :
4mm3_B_1     202:GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPV: 301
SecStr          :GGGGTEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEEE SS EEEEEEEESSSEEEEETTEEEEESEEEEEE:    
ExpBur          :ebebbbbeebbbbeebbeebeeebeeeeebebbbbebebebbbbbbeeeeeebeeeebebbbbeeeeeeeeebbbbbeeebbbebebeeeeeeeebebbb:    
Contact         :  b   bb             bb b      b              b                b    bbbbb                           

queryA      1864:TDVFYKENSYTTTIK:1878
                :******* *******:
4mm3_B_1     302:TDVFYKETSYTTTIK: 316
SecStr          :EEEEEE SEEE    :    
ExpBur          :bbbbbebeebeeeee:    
Contact         :b                                                                                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123