#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4ovz_B_1_G_1

Protein Model on 4ovz_B_1_G_1 (TEMPLATE: 4ovz )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [252 aa] Papain-like proteinase :R1A_CVHSA
2 b G 1 (B) non-polymer(P85) N-[(4-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-ylethyl]piperidine-4-carboxamide 1725L 1726G 1727D 1810P 1811P 1827Y 1830N 1831Y 1832Q 1836Y 1864T (identity: 100.0 %/81.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ovz_B_1 identity=81.0%
queryA      1627:LRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELG:1726
                :** ******** * ***************** *** *********** **   ** *** * *** **** ******** *********** ********:
4ovz_B_1      65:LRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNUYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELG: 164
SecStr          : HHHHHHHH    TTHHHHHHHHHHHHTTS   EETTEE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTT  TT   :    
ExpBur          :eeeeeeeebeeeeeebeeebeebbeebeebebeebbeebbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbeeebeeeb:    
Contact         :                                                                                                  bb

queryA      1727:DVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASE:1826
                :******  * ***** * ********* ***  *** *************   * ** *** **  ** ******* ********* * *  *** ** *:
4ovz_B_1     165:DVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANE: 264
SecStr          : HHHHHHHHHTTB  TT EEEEEEE SSS   EEEE THHHHEEES S HHHHHH EE   TTSS  EEEEEEEESSEEEEEEEEEEEEEETTS SEEEE:    
ExpBur          :ebeebbeebbeebebeebebbbbbebeeeeeeeeebeebebbbbeebbbbeebbeebeeeeeeeeebebbbeebebebbbbbbeeeeeebeeeebebbbb:    
Contact         :b                                                                                  bb               

queryA      1827:YTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK:1878
                :********** *** ***** **** *** ****** ******* *******:
4ovz_B_1     265:YTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIK: 316
SecStr          :EEE SSSEEEEEEEESSSEEEEETTEEEEESEEEEEEEEEEEE SEEE    :    
ExpBur          :beeeeeeeebbbbbeeeebbebebeeeeeeeebebebbbbbbebeeeebeee:    
Contact         :b  bbb   b                           b                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123