Protein Model on 4rsp_A_1_B_1 (TEMPLATE: 4rsp )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1] [assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) A 1 (A) polymer(polypeptide(L)) [304 aa] Orf1a protein :V9TU12_9BETC
2 b B 1 (B) polymer(polypeptide(L)) [5 aa] Peptide inhibitor 3304H 3312M(L) 3403F 3404L 3405N(U) 3406G 3407S 3408C 3426H 3427H(Q) 3428M 3429E 3430L 3435H 3450D 3451R(K) 3452Q 3453T(V) 3454A(H) 3455Q (identity: 70.0 %/52.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4rsp_A_1 identity=52.2%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4rsp_A_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TT  SS  HHHHHHT  GGGEEEEE SSS EE  EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebebbbbbbebeebebbbbbbeebbbbbebbbbeeeeeeebebeebeeebeeeebebebbeeeeeebebebeeeeebbbebebeeebee:    
Contact         :                                        b       b                                                   

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
4rsp_A_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLUGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                                          bbbbbb                 bbbbb    b              bbbbbb     

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4rsp_A_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHH   HHHHHHHHHHHT-T  TT  BTTBSS   S  HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbebbeeeebeebeeeebbee---bbeebebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    

queryA      3560:VRQCSGV:3566
                :  *  **:
4rsp_A_1     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebbbee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123