#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4rsp_A_2_A_1

Protein Model on 4rsp_A_2_A_1 (TEMPLATE: 4rsp )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 2 (A) polymer(polypeptide(L)) [304 aa] Orf1a protein :V9TU12_9BETC
2 b A 1 (A) polymer(polypeptide(L)) [304 aa] Orf1a protein :V9TU12_9BETC 3264S 3265G 3267R(V) 3268K 3269M 3270A(S) 3271F(H) 3272P 3273S 3274G 3277E 3385P 3386S(T) 3387G 3388V(T) 3389Y(F) 3400K 3401G 3402S 3403F 3404L 3429E 3432T(N) 3433G 3435H 3477N 3546G 3547S 3548A(T) 3549L(M) 3562Q 3563C(I) 3565G (identity: 69.7 %/52.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4rsp_A_2 identity=52.2%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4rsp_A_2       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TT  SS  HHHHHHT  GGGEEEEE SSS EE  EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebebbbbbbebeebebbbbbbeebbbbbebbbbeeeeeeebebeebeeebeeeebebebbeeeeeebebebeeeeebbbebebeeebee:    
Contact         :bb bbbbbbbb  b                                                                                      

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * *     **** ******* *******         ***** ***  * * *    *  ** * * *  *   **:
4rsp_A_2     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLUGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                        bbbbb          bbbbb                        b  bb b                         

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4rsp_A_2     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHH   HHHHHHHHHHHT-T  TT  BTTBSS   S  HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbebbeeeebeebeeeebbee---bbeebebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :                b                                                                     bbbb          

queryA      3560:VRQCSGV:3566
                :  *  **:
4rsp_A_2     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebbbee:    
Contact         :  bb b                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123