#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4tww_B_1_D_1

Protein Model on 4tww_B_1_D_1 (TEMPLATE: 4tww )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_CVHSA
2 b D 1 (B) non-polymer(3A7) (2S)-2-({[(3S,4aR,8aS)-2-(4-bromobenzoyl)decahydroisoquinolin-3-yl]methyl}amino)-3-(1H-imidazol-5-yl)propanal 3304H 3309S(A) 3312M 3403F 3404L 3405N 3406G 3407S 3408C 3426H 3427H 3429E 3435H 3450D 3451R(I) 3452Q (identity: 87.5 %/95.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4tww_B_1 identity=95.8%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
4tww_B_1       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  TTTTTS  HHHHHHH  GGGEEEEETTEE  EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eeeeeeeeebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeebbeeeeeeebebeeeeeebebeeeeeeebbbebebeeebeebbe:    
Contact         :                                        b    b  b                                                   

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ******* ************:
4tww_B_1     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTI: 200
SecStr          :EEE    TT B EEEEEETTEEEEEE  B  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeeebebbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebeb:    
Contact         :                                       bbbbbb                 bb b     b              bbb           

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
4tww_B_1     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT  SS       HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   SS HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeebeebebeeebeeeebbebbeeeebeebeeeeeeebeebbeebebebeebbbbbbebbeeebeeeebeeeeebebbbbbebbeebb:    

queryA      3564:SGVTFQ:3569
                :******:
4tww_B_1     301:SGVTFQ: 306
SecStr          : S    :    
ExpBur          :eeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123