Protein Model on 4wmf_A_1_D_1 (TEMPLATE: 4wmf )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1] [assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) A 1 (A) polymer(polypeptide(L)) [304 aa] MERS-CoV 3CL protease :W6A941_9BETC
2 b D 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 3460D 3461T(K) 3462T(Y) 3501N(Q) (identity: 25.0 %/51.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4wmf_A_1 identity=51.5%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  **  ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4wmf_A_1       1:SGLVKMSHPSXDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          -  GGGEEEEEETTEEEEEEEETTEEEEEGGGGS GGGTTS  HHHHHHH  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeee-ebeebbbbbebeebebbbbbbeebbbbbbbbbbeeeebeebebeebeeebeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *  *   **:
4wmf_A_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbeeeeebbbbbbbebebbeebebeeeeeeeeee:    
Contact         :                                                                                                   b

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4wmf_A_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS      HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebeebeeeebbee---bbeeeebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :bb                                      b                                                           

queryA      3560:VRQCSGV:3566
                :  *  **:
4wmf_A_1     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123