Protein Model on 4wmf_C_1_A_1 (TEMPLATE: 4wmf )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1] [assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) C 1 (C) polymer(polypeptide(L)) [289 aa] MERS-CoV 3CL protease :W6A941_9BETC
2 b A 1 (A) polymer(polypeptide(L)) [304 aa] MERS-CoV 3CL protease :W6A941_9BETC 3473A 3476I(L) 3477N 3562Q 3563C(I) 3565G 3566V 3567T(V) 3568F(M) 3569Q (identity: 60.0 %/51.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4wmf_C_1 identity=51.0%
queryA      3274:GKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQ:3370
                :* ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** ** * *    :
4wmf_C_1      11:GDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADXXXDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVK: 110
SecStr          : TTGGGEEEEEETTEEEEEEEETTEEEEEGGGGS   ---   HHHHHHT  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT  SEEE    :    
ExpBur          :eebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeee---ebebeebeeebeeeebebebbeeeeeebebeeeeeeebbbebebeeebeebbeeeeeebe:    

queryA      3371:PGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAW:3470
                :**  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *      **    *** **:
4wmf_C_1     111:PGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELAXGTHTGSAFDGTMYGAFMDKQVXXXQLTDKYCSVNVVAW: 210
SecStr          :TT EEEEEEEETTEEEEEEEEEB TTS EE    TT TT EEEEEETTEEEEEEEEEEE  - EEEEE TTS BGGG   S  ---    SB HHHHHHH:    
ExpBur          :eeeebebbbbbebeebbebebebeeeebbebbbbeebbbbbbbeeeeeebebbbbbbbeee-ebbbbbbbebebbeeeebbee---eeeeebebbbbbbb:    

queryA      3471:LYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ:3569
                :****  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **  *  **  *:
4wmf_C_1     211:LYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ: 306
SecStr          :HHHHHHHT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHT-T  TT  BTTBSS      HHHHHHHHHT    :    
ExpBur          :bbbbbeeebeebeeeeebeeeebbeebeeebbeebeeeebbee---bbeebebbbebbbebbbebb-ebbeeeebeebbbbbeeeebeebbeeeeeeeee:    
Contact         :  b  bb                                                                                     bb bbbbb


Input Residue Numbers for Focused Sites

ex) 2,15,123