Protein Model on 4yoi_B_1_I_1 (TEMPLATE: 4yoi )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) B 1 (B) polymer(polypeptide(L)) [306 aa] 3C-like proteinase :R1AB_BCHK4
2 b I 1 (B) non-polymer(4F4) N-{4-[(1H-benzotriazol-1-ylacetyl)(thiophen-3-ylmethyl)amino]phenyl}thiophene-2-carboxamide 3287T(S) 3288T(M) 3304H 3307C 3309S(A) 3312M(L) 3317Y 3403F 3404L 3405N(C) 3407S 3408C 3426H 3427H(Q) 3428M 3429E 3450D 3451R(K) 3452Q (identity: 63.2 %/51.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4yoi_B_1 identity=51.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** * ******  ********  * ****  *       ***  *** * ** * **        ***  ***    *** ** *** :
4yoi_B_1       1:SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGTTS  HHHHHHH  GGGEEEEE SSS EEE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeebebeebeebbbbbebeeeebbbbbbeebbbbbbbbbbeeeeeeebebeebeeeeeeeebebebeeeeeeebebeeeeeeebbbebebeeebee:    
Contact         :                       bb               b  b b  b    b                                              

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * **     * * ******* *******         * *** ***  * * *    *  ** * * ** *   **:
4yoi_B_1     101:TPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTD: 200
SecStr          :   EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEESSS EEEEEEEEEEEETTEEEEE TTS BSSS  SSSS       :    
ExpBur          :eeeeeeeebeebebbbbbbbeebebeeeebbbbbebbbbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                                          bbb bb                 bbbb                    bbb        

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :   * ** ******* **  **           *  *      *       *    *   **  *  * *     *  *  * ****   ******* **:
4yoi_B_1     201:KYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDM---LAHRTGVSVEQMLAAIQS-LHAGFQGKTILGQSTLEDEFTPDDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHH   HHHHHHHHHH-HHH  TT  BTTBSS      HHHH:    
ExpBur          :eebbbbbbbbbbbbbbeebeebeeeeebeeeebbeebeeeebbebeeeebbee---bbeebebebebbbbbbee-beeebeeeebeeeeebbbbbbbeeb:    

queryA      3560:VRQCSGVTFQ:3569
                :  *  **  *:
4yoi_B_1     297:NMQVMGVVMQ: 306
SecStr          :HHH  S    :    
ExpBur          :eeebeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123