Protein Model on 5c8u_A_1_E_1 (TEMPLATE: 5c8u )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) A 1 (A) polymer(polypeptide(L)) [133 aa] Non-structural protein 10 :R1AB_CVHSA
2 b E 1 (A) non-polymer(ZN) ZINC ION 4327C 4330C 4336H 4343C (identity: 100.0 %/97.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5c8u_A_1 identity=97.7%
queryA      4253:QAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQI:4352
                : ********************** ****************************************************************************:
5c8u_A_1       5:SAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQI: 104
SecStr          :  S     GGGHHHHHHHHH SSHHHHHHHHHHTT        B    S S   SSBSS    SSEEEE  TTT HHHHTT   SSSSS  SSTTSBEEE:    
ExpBur          :eeeeeeeeeebeebbeebeeeeebbebbeeeeeeebebbeebeeeebebeeebebebeeeebeeebbbbbbebbbbbbbbebeeeeeeeeeebeeeebbb:    
Contact         :                                                                          b  b     b      b         

queryA      4353:PTTCANDPVGFTLKNTVCTVCGMWKGYGCSCD:4384
                :************* ******************:
5c8u_A_1     105:PTTCANDPVGFTLRNTVCTVCGMWKGYGCSCD: 136
SecStr          :ETTGGGSHHHHHHH    TTTSS SSS  S  :    
ExpBur          :beebbebbbbbbeeeeebeeeeebeeeeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123