Protein Model on 5e6j_A_1_B_1 (TEMPLATE: 5e6j )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(YP_009725295.1) A 1 (A) polymer(polypeptide(L)) [317 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b B 1 (B) polymer(polypeptide(L)) [76 aa] ubiquitin :UBC_HUMAN 1672N 1674C 1675Y 1725L 1726G 1727D 1729R 1730E 1762L 1766E 1770Y 1771M 1785I 1786P 1788T(V) 1795K(Q) 1811P 1827Y 1831Y 1832Q 1833C 1834G 1835H 1836Y 1864T (identity: 92.0 %/82.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5e6j_A_1 identity=82.0%
queryA      1566:RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLT:1665
                : ********** ***** ***************************  ****** *** ***** ******** * ***************** *** ***:
5e6j_A_1       4:KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLT: 103
SecStr          : EEEEEEESSSS  EEEEEESSS GGGTTSSEEETTEE SSS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   B SSSB:    
ExpBur          :eebebebbbbeeeeeeeebeeeebbeeebeebbbeeeebbeeebeeebeeeebbbebeeeebeebbeebbeeeeeebbbebbebbeebeebebeebeebb:    

queryA      1666:SIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGV:1765
                :***********   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** **:
5e6j_A_1     104:SIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGV: 203
SecStr          :   S TTTHHHHHHHHHHHTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHTT  TT    HHHHHHHHHTTB  TT EEEEEEE SSS EEEEEEEGG:    
ExpBur          :bbeeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbbbbbbbbbbbebeeeeeeebeebbeebbebbebeebebbbbeebeeeeeeeeeeeeb:    
Contact         :      b bb                                                 bbb bb                               b   

queryA      1766:EAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD:1865
                :***********   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** **:
5e6j_A_1     204:EAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD: 303
SecStr          :GGSEEES S SHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE GGG SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEES EEEEEEE:    
ExpBur          :ebbbbeebbbbeebeeeeeeeeeeebebebbbeebebebbbbbbeeeeeebeeeebbbbbbbeeeeeebebbbbbbeeebbebebeeeeeeeebebbbbb:    
Contact         :b   bb             bb b      b               b               b   bbbbbb                           b 

queryA      1866:VFYKENSYTTTIKPVTY:1882
                :***** ********   :
5e6j_A_1     304:VFYKETSYTTTIKPLEH: 320
SecStr          :EEEE S B         :    
ExpBur          :bbbebeebeeeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123